PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_13717A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family M-type_MADS
Protein Properties Length: 157aa    MW: 17289.8 Da    PI: 7.0287
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_13717AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.32.7e-251056248
                               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                               rien+  rqvtf+kRr+g+lKKA ELSvLCda + +iifs +gkly+
  Oropetium_20150105_13717A 10 RIENTVHRQVTFCKRRAGLLKKARELSVLCDAHIGIIIFSAHGKLYD 56
                               8********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.22E-27176IPR002100Transcription factor, MADS-box
SMARTSM004327.2E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.478161IPR002100Transcription factor, MADS-box
CDDcd002656.58E-41279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MARGKVQLRR IENTVHRQVT FCKRRAGLLK KARELSVLCD AHIGIIIFSA HGKLYDLATT  60
GTMEELIERY KTASGEAQQG DGCGGDHRME DMLKAANEIL QEKIVQQNGL LDVGMMVGDQ  120
QNGHFSTVPL IEEITNPLTI LSGYSTCRSS EMGYSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-16370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-16370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-16370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D4e-16370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A4e-16370268Myocyte-specific enhancer factor 2A
3kov_B4e-16370268Myocyte-specific enhancer factor 2A
3kov_I4e-16370268Myocyte-specific enhancer factor 2A
3kov_J4e-16370268Myocyte-specific enhancer factor 2A
3mu6_A3e-16370268Myocyte-specific enhancer factor 2A
3mu6_B3e-16370268Myocyte-specific enhancer factor 2A
3mu6_C3e-16370268Myocyte-specific enhancer factor 2A
3mu6_D3e-16370268Myocyte-specific enhancer factor 2A
3p57_A4e-16370268Myocyte-specific enhancer factor 2A
3p57_B4e-16370268Myocyte-specific enhancer factor 2A
3p57_C4e-16370268Myocyte-specific enhancer factor 2A
3p57_D4e-16370268Myocyte-specific enhancer factor 2A
3p57_I4e-16370268Myocyte-specific enhancer factor 2A
3p57_J4e-16370268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033262e-79AB003326.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:R3786.
GenBankAK0691222e-79AK069122.1 Oryza sativa Japonica Group cDNA clone:J023004P21, full insert sequence.
GenBankAY5519252e-79AY551925.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927866.13e-55PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK99e-50MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G89e-50MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLR7W5851e-83R7W585_AEGTA; MADS-box transcription factor 26
STRINGBGIOSGA027872-PA2e-81(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.16e-37AGAMOUS-like 12